PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cc11_g10520
Common NameGSCOC_T00032567001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Rubiaceae; Ixoroideae; Coffeeae; Coffea
Family G2-like
Protein Properties Length: 393aa    MW: 42445.7 Da    PI: 9.0726
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cc11_g10520genomeCGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like98.54.5e-31224279156
      G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                  k r++W+peLH+rF+ a++qLGG+++AtPk+i+elmkv+gLt+++vkSHLQkYRl+
  Cc11_g10520 224 KSRRCWSPELHKRFLLALQQLGGAHVATPKQIRELMKVDGLTNDEVKSHLQKYRLH 279
                  68****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.717221281IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.0E-27221282IPR009057Homeodomain-like
SuperFamilySSF466892.82E-17222281IPR009057Homeodomain-like
TIGRFAMsTIGR015572.0E-26224279IPR006447Myb domain, plants
PfamPF002495.6E-7226277IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 393 aa     Download sequence    Send to blast
MQRTQEYIDS LEEERRKILV FQRELPLCLE LVTQAIETCK QQLSSGTTVT EYNFHGQSEC  60
SEQTSTDGPV LEEFIPIKRA LSSDDDEQQS RKPKKSNISN GNDKDNKSNN NDKAASSKKS  120
DWLRSVQLWN QTPDPPQKED SPKKVSVVEV KRNGSSGGAF HPFKKEKSIG ANAGKLDVPK  180
SGDKTSIPAA EASSTEETGG TSGGGGGGNG GSKKEEKEGQ SQRKSRRCWS PELHKRFLLA  240
LQQLGGAHVA TPKQIRELMK VDGLTNDEVK SHLQKYRLHN RRPSPSIHSN NNPQAPQFVV  300
VGGIWVPPPE YAAMAATTGS GEASGGANSN GIYAPIPTLP PPFHDPSASL KQKQRHKQLH  360
SDDRGSNSGG GGHSNSHSTS SSTDTATTSP NY*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00160DAPTransfer from AT1G25550Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003631224.11e-163PREDICTED: probable transcription factor GLK2
TrEMBLA0A068TX100.0A0A068TX10_COFCA; Uncharacterized protein
STRINGVIT_01s0011g03110.t011e-163(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA52192438
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G25550.16e-85G2-like family protein